PDB entry 2cpq

View 2cpq on RCSB PDB site
Description: Solution structure of the N-terminal KH domain of human FXR1
Class: RNA binding protein
Keywords: KH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fragile X mental retardation syndrome related protein 1, isoform b'
  Species: HOMO SAPIENS
  Gene: FXR1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51114 (7-84)
    • cloning artifact (0-6)
    • cloning artifact (85-90)
  Domains in SCOP 1.73: d2cpqa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpqA (A:)
  gssgssgtkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfri
  ygesadavkkargflefvedfiqvpsgpssg