PDB entry 2cpq

View 2cpq on RCSB PDB site
Description: Solution structure of the N-terminal KH domain of human FXR1
Class: RNA binding protein
Keywords: KH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fragile X mental retardation syndrome related protein 1, isoform b'
    Species: Homo sapiens [TaxId:9606]
    Gene: FXR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51114 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOPe 2.08: d2cpqa1, d2cpqa2, d2cpqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cpqA (A:)
gssgssgtkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfri
ygesadavkkargflefvedfiqvpsgpssg