PDB entry 2cpp

View 2cpp on RCSB PDB site
Description: high-resolution crystal structure of cytochrome p450-cam
Class: oxidoreductase(oxygenase)
Keywords: oxidoreductase(oxygenase)
Deposited on 1987-04-06, released 1987-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2cppa_
  • Heterogens: HEM, CAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cppA (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cppA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav