PDB entry 2cpp

View 2cpp on RCSB PDB site
Description: high-resolution crystal structure of cytochrome p450-cam
Deposited on 1987-04-06, released 1987-07-16
The last revision prior to the SCOP 1.55 freeze date was dated 1991-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.63 Å
R-factor: 0.19
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2cpp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpp_ (-)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav