PDB entry 2cpn

View 2cpn on RCSB PDB site
Description: Solution structure of the second dsRBD of TAR RNA-binding protein 2
Class: gene regulation
Keywords: double-stranded RNA binding domain, dsRBD, DSRM., Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR RNA-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TARBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15633 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.06: d2cpna1, d2cpna2, d2cpna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cpnA (A:)
gssgssgpvspqqsecnpvgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfi
eigsgtskklakrnaaakmllrvsgpssg