PDB entry 2cpi

View 2cpi on RCSB PDB site
Description: Solution structure of the RNA recognition motif of CNOT4
Class: gene regulation
Keywords: RNA recognition motif, RRM, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CCR4-NOT transcription complex subunit 4
  Species: Mus musculus [TaxId:10090]
  Gene: Cnot4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BT14 (7-104)
    • cloning artifact (0-6)
    • cloning artifact (105-110)
  Domains in SCOPe 2.05: d2cpia1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpiA (A:)
  gssgssgasvrvvqknlvfvvglsqrladpevlkrpeyfgkfgkihkvvinnstsyagsq
  gpsasayvtyirsedalraiqcvnnvvvdgrtlkaslgttkycsysgpssg