PDB entry 2cpi

View 2cpi on RCSB PDB site
Description: Solution structure of the RNA recognition motif of CNOT4
Class: gene regulation
Keywords: RNA recognition motif, RRM, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 4
    Species: MUS MUSCULUS
    Gene: Cnot4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BT14 (7-104)
      • cloning artifact (0-6)
      • cloning artifact (105-110)
    Domains in SCOP 1.73: d2cpia1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpiA (A:)
    gssgssgasvrvvqknlvfvvglsqrladpevlkrpeyfgkfgkihkvvinnstsyagsq
    gpsasayvtyirsedalraiqcvnnvvvdgrtlkaslgttkycsysgpssg