PDB entry 2cpg

View 2cpg on RCSB PDB site
Description: transcriptional repressor copg
Deposited on 1999-11-15, released 1999-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-23, with a file datestamp of 1999-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2cpga_
  • Chain 'B':
    Domains in SCOP 1.55: d2cpgb_
  • Chain 'C':
    Domains in SCOP 1.55: d2cpgc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpgA (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpgB (B:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqer
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpgC (C:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkg