PDB entry 2cpg

View 2cpg on RCSB PDB site
Description: transcriptional repressor copg
Class: gene regulation
Keywords: transcriptional repressor, DNA-binding protein, plasmid, gene regulation
Deposited on 1999-11-15, released 1999-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional repressor copg
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cpga_
  • Chain 'B':
    Compound: transcriptional repressor copg
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13920 (0-44)
      • conflict (44)
    Domains in SCOPe 2.07: d2cpgb_
  • Chain 'C':
    Compound: transcriptional repressor copg
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cpgc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cpgA (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cpgA (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpgB (B:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cpgC (C:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cpgC (C:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkg