PDB entry 2cpf

View 2cpf on RCSB PDB site
Description: Solution structure of the penultimate RNA recognition motif of hypothetical RNA-binding protein RBM19
Class: structural genomics, unknown function
Keywords: RNA recognition motif, RRM, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA binding motif protein 19
  Species: Mus musculus [TaxId:10090]
  Gene: Rbm19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R3C6 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOPe 2.08: d2cpfa1, d2cpfa2, d2cpfa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpfA (A:)
  gssgssglfiknlnfstteetlkgvfskvgaiksctiskkknkagvllsmgfgfveykkp
  eqaqkalkqlqghtvdghklevriseratkpasgpssg