PDB entry 2cpe

View 2cpe on RCSB PDB site
Description: Solution structure of the RNA recognition motif of Ewing Sarcoma(EWS) protein
Class: oncoprotein
Keywords: RNA recognition motif, RRM, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ONCOPROTEIN
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein EWS
    Species: Homo sapiens [TaxId:9606]
    Gene: EWSR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01844 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-112)
    Domains in SCOPe 2.07: d2cpea1, d2cpea2, d2cpea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpeA (A:)
    gssgssgdpdedsdnsaiyvqglndsvtlddladffkqcgvvkmnkrtgqpmihiyldke
    tgkpkgdatvsyedpptakaavewfdgkdfqgsklkvslarkkppmnsgpssg