PDB entry 2cpd

View 2cpd on RCSB PDB site
Description: Solution structure of the RNA recognition motif of human APOBEC-1 complementation factor, ACF
Class: gene regulation
Keywords: RNA recognition motif, RRM, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: APOBEC-1 stimulating protein
  Species: Homo sapiens [TaxId:9606]
  Gene: ASP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NQ93 (7-92)
    • cloning artifact (0-6)
    • cloning artifact (93-98)
  Domains in SCOPe 2.07: d2cpda1, d2cpda2, d2cpda3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpdA (A:)
  gssgssgdedtmssvkilyvrnlmlstseemiekefnnikpgavervkkirdyafvhfsn
  redaveamkalngkvldgspievtlakpvdkdssgpssg