PDB entry 2cp8

View 2cp8 on RCSB PDB site
Description: Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
Class: protein binding
Keywords: UBA domain, structural genomics, human, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Next to BRCA1 gene 1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14596 (7-47)
      • cloning artifact (0-6)
      • see remark 999 (14)
      • cloning artifact (48-53)
    Domains in SCOPe 2.08: d2cp8a1, d2cp8a2, d2cp8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cp8A (A:)
    gssgssgqtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellqlsgpssg