PDB entry 2cp7

View 2cp7 on RCSB PDB site
Description: Solution structure of the 1st CAP-Gly domain in mouse CLIP-170/restin
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, restin, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restin
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4631429H07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q922J3 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.08: d2cp7a1, d2cp7a2, d2cp7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cp7A (A:)
gssgssgfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfq
ceplkgiftrpskltrkvsgpssg