PDB entry 2cp6

View 2cp6 on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, restin, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Restin
  Species: HOMO SAPIENS
  Gene: FB2383_D01
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30622 (7-165)
    • cloning artifact (0-6)
    • cloning artifact (166-171)
  Domains in SCOP 1.75: d2cp6a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cp6A (A:)
  gssgssgatppisnltktasesisnlseagsikkgerelkigdrvlvggtkagvvrflge
  tdfakgewcgveldeplgkndgavagtryfqcqpkyglfapvhkvtkigfpsttpakaka
  navrrvmattsaslkrspsasslssmssvassvssrpsrtglltetsgpssg