PDB entry 2cp5

View 2cp5 on RCSB PDB site
Description: Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, restin, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: FB2383_D01
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30622 (7-134)
      • cloning artifact (0-6)
      • cloning artifact (135-140)
    Domains in SCOPe 2.08: d2cp5a1, d2cp5a2, d2cp5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cp5A (A:)
gssgssgmsmlkpsglkaptkilkpgstalktptavvapvektissekasstpssetqee
fvddfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqcep
lkgiftrpskltrkvsgpssg