PDB entry 2cp3

View 2cp3 on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, CYLN2, KIAA0291, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: clip-115
  Species: HOMO SAPIENS
  Gene: Kazusa cDNA fh25236
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UDT6 (7-77)
    • cloning artifact (0-6)
    • cloning artifact (78-83)
  Domains in SCOP 1.75: d2cp3a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cp3A (A:)
  gssgssglrlgdrvlvggtktgvvryvgetdfakgewcgveldeplgkndgavagtryfq
  cppkfglfapihkvirigsgpssg