PDB entry 2cp3

View 2cp3 on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, CYLN2, KIAA0291, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clip-115
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA fh25236
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UDT6 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.08: d2cp3a1, d2cp3a2, d2cp3a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cp3A (A:)
    gssgssglrlgdrvlvggtktgvvryvgetdfakgewcgveldeplgkndgavagtryfq
    cppkfglfapihkvirigsgpssg