PDB entry 2coz

View 2coz on RCSB PDB site
Description: Solution structure of the CAP-Gly domain in human centrosome-associated protein CAP350
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: centrosome-associated protein 350
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA hh00807
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WY20 (7-115)
    • cloning artifact (0-6)
    • cloning artifact (116-121)
  Domains in SCOPe 2.08: d2coza1, d2coza2, d2coza3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cozA (A:)
  gssgssgveheqqvtespslasvptadelfdfhigdrvlignvqpgilrfkgetsfakgf
  wagveldkpegnnngtydgiayfeckekhgifappqkishipenfddyvdinededsgps
  sg