PDB entry 2coy

View 2coy on RCSB PDB site
Description: Solution structure of the CAP-Gly domain in human Dynactin 1
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, p150-glued, DAP-150, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: FB1898_A06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14203 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.03: d2coya1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2coyA (A:)
gssgssgmaqskrhvysrtpsgsrmsaeasarplrvgsrvevigkghrgtvayvgatlfa
tgkwvgvildeakgkndgtvqgrkyftcdeghgifvrqsqiqvfedsgpssg