PDB entry 2cow

View 2cow on RCSB PDB site
Description: Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, KIAA0639, Kinesin-like protein GAKIN, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF13B
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hj03358
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NQT8 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.05: d2cowa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cowA (A:)
    gssgssgqalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldl
    psgkndgsiggkqyfrcnpgygllvrpsrvrratsgpssg