PDB entry 2cos

View 2cos on RCSB PDB site
Description: Solution structure of RSGI RUH-038, a UBA domain from Mouse LATS2 (Large Tumor Suppressor homolog 2)
Class: transferase
Keywords: UBA domain, Mus musculus, structure genomics, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-05-18, released 2005-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine protein kinase LATS2
    Species: Mus musculus [TaxId:10090]
    Gene: AV362185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TSJ6 (7-47)
      • cloning artifact (0-6)
      • cloning artifact (48-53)
    Domains in SCOPe 2.07: d2cosa1, d2cosa2, d2cosa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cosA (A:)
    gssgssgvnrqmlqelvnagcdqemagralkqtgsrsieaaleyiskmsgpssg