PDB entry 2cor

View 2cor on RCSB PDB site
Description: Solution structure of the third LIM domain of particularly interesting new Cys-His protein
Class: Structural protein
Keywords: LIM domain, PINCH protein, Particularly interesting new Cys-His protein, LIM and senescent cell antigen-like domains 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
Deposited on 2005-05-18, released 2005-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PINCH protein
  Species: Homo sapiens [TaxId:9606]
  Gene: LIMS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48059 (7-72)
    • cloning artifact (0-6)
    • cloning artifact (73-78)
  Domains in SCOPe 2.08: d2cora1, d2cora2, d2cora3, d2cora4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2corA (A:)
  gssgssgekarglgkyicqkchaiideqplifkndpyhpdhfncancgkeltadarelkg
  elyclpchdkmgvsgpssg