PDB entry 2coi

View 2coi on RCSB PDB site
Description: Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin
Class: transferase
Keywords: PLP-dependent enzyme, TRANSFERASE
Deposited on 2005-05-17, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched chain aminotransferase 1, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54687
      • engineered (378)
    Domains in SCOPe 2.07: d2coia_
  • Chain 'B':
    Compound: branched chain aminotransferase 1, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54687
      • engineered (378)
    Domains in SCOPe 2.07: d2coib_
  • Heterogens: MG, PLP, GBN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2coiA (A:)
    mkdcsngcsaectgeggskevvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltv
    ewssefgwekphikplqnlslhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrm
    yrsavratlpvfdkeelleciqqlvkldqewvpystsaslyirptfigtepslgvkkptk
    allfvllspvgpyfssgtfnpvslwanpkyvrawkggtgdckmggnygsslfaqceavdn
    gcqqvlwlygedhqitevgtmnlflywinedgeeelatppldgiilpgvtrrcildlahq
    wgefkvseryltmddlttalegnrvremfgsgtacvvcpvsdilykgetihiptmengpk
    lasrilskltdiqygreerdwtivls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2coiA (A:)
    vgtfkakdlivtpatilkekpdpnlvfgtvftdhmltvewssefgwekphikplqnlslh
    pgssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleciq
    qlvkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyfnpvslwan
    pkyvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtmnlflyw
    inedgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegnrvre
    mfgsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdwtivl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2coiB (B:)
    mkdcsngcsaectgeggskevvgtfkakdlivtpatilkekpdpnnlvfgtvftdhmltv
    ewssefgwekphikplqnlslhpgssalhyavelfeglkafrgvdnkirlfqpnlnmdrm
    yrsavratlpvfdkeelleciqqlvkldqewvpystsaslyirptfigtepslgvkkptk
    allfvllspvgpyfssgtfnpvslwanpkyvrawkggtgdckmggnygsslfaqceavdn
    gcqqvlwlygedhqitevgtmnlflywinedgeeelatppldgiilpgvtrrcildlahq
    wgefkvseryltmddlttalegnrvremfgsgtacvvcpvsdilykgetihiptmengpk
    lasrilskltdiqygreerdwtivls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2coiB (B:)
    tfkakdlivtpatilkekpdpnlvfgtvftdhmltvewssefgwekphikplqnlslhpg
    ssalhyavelfeglkafrgvdnkirlfqpnlnmdrmyrsavratlpvfdkeelleciqql
    vkldqewvpystsaslyirptfigtepslgvkkptkallfvllspvgpyfnpvslwanpk
    yvrawkggtgdckmggnygsslfaqceavdngcqqvlwlygedhqitevgtmnlflywin
    edgeeelatppldgiilpgvtrrcildlahqwgefkvseryltmddlttalegnrvremf
    gsgtacvvcpvsdilykgetihiptmengpklasrilskltdiqygreerdwtivl