PDB entry 2coh

View 2coh on RCSB PDB site
Description: Crystal Structure of Transcriptional Regulator TTHA1359 form Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: helix-turn-helix, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-12-04, with a file datestamp of 2007-11-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.223
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d2coha3, d2coha4
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cohA (A:)
    mtqvretvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffg
    eealfgqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatqrlk
    nrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyirsgy
    gkiqlldlkglkelaesrgqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cohA (A:)
    etvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealf
    gqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatqrlknrmaa
    allelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyirsgygkiql
    ldlkglkelaesrg