PDB entry 2cof

View 2cof on RCSB PDB site
Description: Solution structure of the C-terminal PH domain of hypothetical protein KIAA1914 from human
Class: structural genomics, unknown function
Keywords: Hypothetical protein KIAA1914, PH domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein KIAA1914
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1914
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8N4X5 (7-100)
    • cloning artifact (0-6)
    • cloning artifact (101-106)
  Domains in SCOPe 2.06: d2cofa1, d2cofa2, d2cofa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cofA (A:)
  gssgssgletssylnvlvnsqwksrwcsvrdnhlhfyqdrnrskvaqqplslvgcevvpd
  pspdhlysfrilhkgeelakleaksseemghwlglllsesgsgpssg