PDB entry 2cod

View 2cod on RCSB PDB site
Description: The deposition and citation title is: Solution structure of the N-terminal PH domain of ARAP2 protein from human
Class: signaling protein
Keywords: Arf GAP and Rho GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Centaurin-delta 1
  Species: HOMO SAPIENS
  Gene: ARAP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WZ64 (7-108)
    • cloning artifact (0-6)
    • cloning artifact (109-114)
  Domains in SCOP 1.75: d2coda1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2codA (A:)
  gssgssgkvksgwldklspqgkrmfqkrwvkfdglsisyynnekemyskgiiplsaistv
  rvqgdnkfevvttqrtfvfrvekeeerndwisillnalksqsltsqsqasgpssg