PDB entry 2cod

View 2cod on RCSB PDB site
Description: Solution structure of the N-terminal PH domain of ARAP2 protein from human
Class: signaling protein
Keywords: Arf GAP and Rho GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centaurin-delta 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARAP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ64 (7-108)
      • expression tag (0-6)
      • expression tag (109-114)
    Domains in SCOPe 2.08: d2coda1, d2coda2, d2coda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2codA (A:)
gssgssgkvksgwldklspqgkrmfqkrwvkfdglsisyynnekemyskgiiplsaistv
rvqgdnkfevvttqrtfvfrvekeeerndwisillnalksqsltsqsqasgpssg