PDB entry 2coc

View 2coc on RCSB PDB site
Description: Solution structure of the C-terminal PH domain of FYVE, RhoGEF and PH domain containing protein 3 (FGD3) from human
Class: signaling protein
Keywords: FYVE, RhoGEF and PH domain containing protein 3, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FYVE, RhoGEF and PH domain containing protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: FGD3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5JSP0 (7-105)
    • cloning artifact (0-6)
    • cloning artifact (106-111)
  Domains in SCOPe 2.08: d2coca1, d2coca2, d2coca3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cocA (A:)
  gssgssgsllcgplrlsesgetwsevwaaipmsdpqvlhlqggsqdgrlprtiplpsckl
  svpdpeerldsghvwklqwakqswylsassaelqqqwletlstaahsgpssg