PDB entry 2cob

View 2cob on RCSB PDB site
Description: Solution structures of the HTH domain of human LCoR protein
Class: DNA binding protein
Keywords: MLR2, KIAA1795, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LCoR protein
    Species: HOMO SAPIENS
    Gene: MLR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VW16 (7-69)
      • cloning artifact (0-6)
    Domains in SCOP 1.73: d2coba1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cobA (A:)
    gssgssgrgryrqynseileeaisvvmsgkmsvskaqsiygiphstleykvkerlgtlkn
    ppkkkmklmr