PDB entry 2coa

View 2coa on RCSB PDB site
Description: Solution structure of the PH domain of protein kinase C, D2 type from human
Class: signaling protein
Keywords: Protein kinase D2, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, D2 type
    Species: Homo sapiens [TaxId:9606]
    Gene: PKD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZL6 (7-118)
      • cloning artifact (0-6)
      • cloning artifact (119-124)
    Domains in SCOPe 2.06: d2coaa1, d2coaa2, d2coaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2coaA (A:)
    gssgssgtlregwvvhysnkdtlrkrhywrldckcitlfqnnttnryykeiplseiltve
    saqnfslvppgtnphcfeivtanatyfvgempggtpggpsgqgaeaargwetairqalms
    gpssg