PDB entry 2co8

View 2co8 on RCSB PDB site
Description: Solution structures of the LIM domain of human NEDD9 interacting protein with calponin homology and LIM domains
Class: metal binding protein
Keywords: LIM domain, zinc finger protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NEDD9 interacting protein with calponin homology and LIM domains
  Species: HOMO SAPIENS
  Gene: NICAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TDZ2 (7-75)
    • cloning artifact (0-6)
    • cloning artifact (76-81)
  Domains in SCOP 1.73: d2co8a1, d2co8a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2co8A (A:)
  gssgssgqhqeagagdlcalcgehlyvlerlcvnghffhrscfrchtceatlwpggyeqh
  pgdghfyclqhlpqtdsgpssg