PDB entry 2co7

View 2co7 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with the safb chaperone (type II)
Class: fibril protein
Keywords: pilus subunit, chaperone, adhesion, strand complementation, pathogenesis, fibril protein
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: safa pilus subunit
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2CO7
    • Uniprot Q8ZRK4 (2-126)
    Domains in SCOPe 2.03: d2co7a1
  • Chain 'B':
    Compound: putative fimbriae assembly chaperone
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2co7b1, d2co7b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2co7A (A:)
    gspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrva
    gkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitl
    dvvgyqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co7A (A:)
    pqdltvslipvknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagigvglss
    dslrrsdstekwngvnwmtfnsndtldivltgpaqntadtypitldvvgyqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2co7B (B:)
    vnqqlnsatklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapfl
    vmpplfrleanqqsqlrivrtggdmptdretlqwvcikavppenepsdtqakgatldlnl
    sinacdklifrpdavkgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgl
    eyvppfadktlnmpgsahgdiewrvitdfggeshpfhyvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co7B (B:)
    atklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpplfr
    leanqqsqlrivrtggdmptdretlqwvcikavppetldlnlsinacdklifrpdavkgt
    pedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnhgdiew
    rvitdfggeshpfhyvlk