PDB entry 2co6

View 2co6 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with the safb chaperone (type I)
Class: fibril protein
Keywords: pilus subunit, adhesion, strand complementation, pathogenesis, chaperone, fibril protein
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative outer membrane protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CO6 (0-1)
    • Uniprot Q8ZRK4 (2-124)
    Domains in SCOPe 2.08: d2co6a_
  • Chain 'B':
    Compound: putative fimbriae assembly chaperone
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2co6b1, d2co6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2co6A (A:)
    gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
    ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
    vgyqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2co6B (B:)
    vnqqlnsatklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapfl
    vmpplfrleanqqsqlrivrtggdmptdretlqwvcikavppenepsdtqakgatldlnl
    sinacdklifrpdavkgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgl
    eyvppfadktlnmpgsahgdiewrvitdfggeshpfhyvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co6B (B:)
    lnsatklfsvklgatrviyhagtgatlsvsnpqnypilvqssvkaadksspapflvmppl
    frleanqqsqlrivrtggdmptdretlqwvcikavppenepgatldlnlsinacdklifr
    pdavkgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktl
    nmpgshgdiewrvitdfggeshpfhyvl