PDB entry 2co4

View 2co4 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide
Class: fibril protein
Keywords: pilus subunit adhesion pathogenesis, fibril protein, fold complementation
Deposited on 2006-05-25, released 2006-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative outer membrane protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2co4a_
  • Chain 'B':
    Compound: putative outer membrane protein
    Species: SALMONELLA TYPHIMURIUM, synthetic [TaxId:602]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2co4A (A:)
    gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
    ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
    vgyqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co4A (A:)
    dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
    gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
    yqp
    

  • Chain 'B':
    No sequence available.