PDB entry 2co3

View 2co3 on RCSB PDB site
Description: Salmonella enterica SafA pilin, head-to-tail swapped dimer of Ntd1 mutant
Class: fibril protein
Keywords: pilus subunit, adhesion, pathogenesis, fibril protein, fold complementation
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: safa pilus subunit
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2co3a1
  • Chain 'B':
    Compound: safa pilus subunit
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2co3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2co3A (A:)
    gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
    dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
    vtadtypitldvvgyqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co3A (A:)
    gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
    dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
    vtadtypitldvvgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2co3B (B:)
    gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
    dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
    vtadtypitldvvgyqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2co3B (B:)
    gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
    dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
    vtadtypitldvvgyq