PDB entry 2co2

View 2co2 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f3a mutant)
Class: fibril protein
Keywords: pilus subunit, fibril protein, fold complementation
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: safa pilus subunit
    Species: SALMONELLA ENTERICA [TaxId:28901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2co2a_
  • Chain 'B':
    Compound: safa n-terminal extension
    Species: SALMONELLA ENTERICA, synthetic [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2co2A (A:)
gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
vgyqp

    Sequence, based on observed residues (ATOM records): (download) 
    >2co2A (A:)
ltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagkntg
keigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvgy
q

  • Chain 'B':
    No sequence available.