PDB entry 2co1

View 2co1 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
Class: fibril protein
Keywords: pilus subunit, fibril protein, fold complementation
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative outer membrane protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CO1
    • Uniprot Q8ZRK4 (2-124)
    Domains in SCOPe 2.03: d2co1a_
  • Chain 'B':
    Compound: putative outer membrane protein
    Species: SALMONELLA TYPHIMURIUM, synthetic [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRK4 (0-19)
      • engineered mutation (16)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2co1A (A:)
gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
vgyqp

    Sequence, based on observed residues (ATOM records): (download) 
    >2co1A (A:)
dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
yqp

  • Chain 'B':
    No sequence available.