PDB entry 2cnv

View 2cnv on RCSB PDB site
Description: saicar-synthase from saccharomyces cerevisiae complexed saicar
Class: ligase
Keywords: ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) syn ligase, synthetase, acetylation, atpbinding protein, purine biosynthesis
Deposited on 2006-05-24, released 2006-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole-succinocarboxamide synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNV
      • conflict see remark 9 (183)
    • Uniprot P27616 (0-304)
    Domains in SCOPe 2.07: d2cnva_
  • Heterogens: ASP, SSS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnvA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnvA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkdenispaqaaelvgedl
    srrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwnga
    sykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskwsh