PDB entry 2cnu

View 2cnu on RCSB PDB site
Description: Atomic resolution structure of SAICAR-synthase from Saccharomyces cerevisiae complexed with aspartic acid
Class: ligase
Keywords: ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) syn ligase, ATP binding protein, purine biosynthesis
Deposited on 2006-05-24, released 2006-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.134
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole-succinocarboxamide synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNU
    • Uniprot P27616 (0-304)
    Domains in SCOPe 2.07: d2cnua_
  • Heterogens: ASP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnuA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnuA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaehdenispaqaaelvg
    edlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfw
    ngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw
    sh