PDB entry 2cnu

View 2cnu on RCSB PDB site
Description: atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with aspartic acid
Class: ligase
Keywords: phosphoribosylaminoimidazolesuccinocarboxamide (saicar) syn ligase, synthetase, acetylation, atpbinding protein, purine biosynthesis
Deposited on 2006-05-24, released 2006-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.13383
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole-succinocarboxamide synthase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNU (0-304)
    Domains in SCOP 1.73: d2cnua1
  • Heterogens: SO4, ACE, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnuA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
    lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
    rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
    skwsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnuA (A:)
    sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
    efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
    rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaehdenispaqaaelvg
    edlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfw
    ngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw
    sh