PDB entry 2cnj

View 2cnj on RCSB PDB site
Description: nmr studies on the interaction of insulin-growth factor II (igf-II) with igf2r domain 11
Class: receptor
Keywords: transport, polymorphism, glycoprotein, transmembrane, nmr, igf2r, cancer, membrane, receptor, lysosome, insulin-like growth factor-II
Deposited on 2006-05-22, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717 (Start-142)
    • PDB 2CNJ (143-End)
    Domains in SCOPe 2.08: d2cnjd2, d2cnjd3

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cnjD (D:)
    mksnehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacf
    gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
    sldkqtctlffswhtplaceqatkehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnjD (D:)
    snehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgq
    trisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisl
    dkqtctlffswhtplaceqatkeh