PDB entry 2cnd

View 2cnd on RCSB PDB site
Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its ADP complex and an active site mutant and modeling of the cytochrome b domain
Class: oxidoreductase
Keywords: nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor
Deposited on 1995-02-01, released 1995-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadh-dependent nitrate reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17571 (Start-269)
      • conflict (10-11)
      • conflict (18)
      • conflict (53)
      • conflict (134)
      • conflict (136)
    Domains in SCOPe 2.06: d2cnda1, d2cnda2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cndA (A:)
    vrapalsnprgrihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklc
    mraytptsmvdeighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghve
    ytgrgsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrtedd
    illrdeldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlal
    acgpppmiqfaispnlekmkydmansfvvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cndA (A:)
    grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
    deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgrgsfvin
    gkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillrdeldrw
    aaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgpppmiqf
    aispnlekmkydmansfvvf