PDB entry 2cnb

View 2cnb on RCSB PDB site
Description: trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose
Class: epimerase
Keywords: epimerase, short-chain dehydrogenase/reductase, udp-galactose-4- epimerase, nad, isomerase, trypanosoma brucei, udp-4-deoxy- 4-fluoro-alpha-d-galactose
Deposited on 2006-05-18, released 2006-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose-4-epimerase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNB (0-1)
    • Uniprot Q8T8E9 (2-End)
    Domains in SCOPe 2.02: d2cnba_
  • Chain 'B':
    Compound: udp-galactose-4-epimerase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNB (0-1)
    • Uniprot Q8T8E9 (2-End)
    Domains in SCOPe 2.02: d2cnbb_
  • Chain 'C':
    Compound: udp-galactose-4-epimerase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNB (0-1)
    • Uniprot Q8T8E9 (2-End)
    Domains in SCOPe 2.02: d2cnbc_
  • Chain 'D':
    Compound: udp-galactose-4-epimerase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CNB (0-1)
    • Uniprot Q8T8E9 (2-End)
    Domains in SCOPe 2.02: d2cnbd_
  • Heterogens: UFG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnbA (A:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnbA (A:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptnaepidinakkspespygeskliaermi
    rdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapddkrmpif
    gtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrev
    ievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrt
    hpngya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cnbB (B:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnbB (B:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptaepidinakkspespygeskliaermir
    dcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpifgtd
    yptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvreviev
    arkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrthpn
    gya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cnbC (C:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnbC (C:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptaepidinakkspespygeskliaermir
    dcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdtdkrmpif
    gtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrev
    ievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrt
    hpngya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cnbD (D:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnbD (D:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptnaepidinakkspespygeskliaermi
    rdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpifgt
    dyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrevie
    varkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrthp
    ngya