PDB entry 2cn8

View 2cn8 on RCSB PDB site
Description: crystal structure of human chk2 in complex with debromohymenialdisine
Class: transferase
Keywords: ATP-binding, transferase, kinase domain, phosphorylation, tumour suppressor, activation segment, li-fraumeni syndrome, serine/threonine-protein kinase, chk2, cds1, rad53, chek2, kinase, cancer, checkpoint, nucleotide-binding, hypothetical protein
Deposited on 2006-05-18, released 2006-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase chk2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cn8a_
  • Heterogens: MG, NO3, DBQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cn8A (A:)
    gplgshmsvypkalrdeyimsktlgsgacgevklaferktckkvaikiiskrkfaigsar
    eadpalnveteieilkklnhpciikiknffdaedyyivlelmeggelfdkvvgnkrlkea
    tcklyfyqmllavqylhengiihrdlkpenvllssqeedclikitdfghskilgetslmr
    tlcgtptylapevlvsvgtagynravdcwslgvilficlsgyppfsehrtqvslkdqits
    gkynfipevwaevsekaldlvkkllvvdpkarftteealrhpwlqdedmkrkfqdllsee
    nestalpqvlaqpstsrkrpregeaegae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cn8A (A:)
    ypkalrdeyimsktlgsevklaferktckkvaikiisknveteieilkklnhpciikikn
    ffdaedyyivlelmeggelfdkvvgnkrlkeatcklyfyqmllavqylhengiihrdlkp
    envllssqeedclikitdfghskiltslmrtlcptylapevlvsvgtagynravdcwslg
    vilficlsgyppfsehvslkdqitsgkynfipevwaevsekaldlvkkllvvdpkarftt
    eealrhpwlqdedmkrkfqdllseen