PDB entry 2cn4

View 2cn4 on RCSB PDB site
Description: the crystal structure of the secreted dimeric form of the hemophore hasa reveals a domain swapping with an exchanged heme ligand
Class: transport protein
Keywords: domain swapping, transport protein, heme, iron, dimeric form, metal-binding
Deposited on 2006-05-18, released 2006-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemophore hasa
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cn4a_
  • Chain 'B':
    Compound: hemophore hasa
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cn4b_
  • Heterogens: HEM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cn4A (A:)
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cn4B (B:)
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata