PDB entry 2cmy

View 2cmy on RCSB PDB site
Description: crystal complex between bovine trypsin and veronica hederifolia trypsin inhibitor
Class: hydrolase
Keywords: acyl-enzyme intermediate, serine protease inhibitor, zymogen, protease, digestion, hydrolase, metal-binding, serine protease
Deposited on 2006-05-16, released 2007-05-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2cmya_
  • Chain 'B':
    Compound: veronica hederifolia trypsin inhibitor
    Species: VERONICA HEDERIFOLIA [TaxId:202477]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CMY
    Domains in SCOPe 2.03: d2cmyb1
  • Heterogens: SO4, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cmyA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2cmyB (B:)
ntdpeqckvmcyaqrhsspellrrcldncekehd

    Sequence, based on observed residues (ATOM records): (download) 
    >2cmyB (B:)
ckvmcyaqrspellrrcldnc