PDB entry 2cmx

View 2cmx on RCSB PDB site
Description: structure of a DNA binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
Class: DNA binding protein
Keywords: sulfolobus spindle virus, thermophilic protein, hypothetical protein, ssv, winged-helix, crenarchaeal, DNA binding protein
Deposited on 2006-05-15, released 2006-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical 13.2 kda protein
  Species: Sulfolobus virus-like particle SSV1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20220
  Domains in SCOPe 2.08: d2cmxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2cmxA (A:)
  mhhhhhhaqtlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerh
  pdecevqyknrkttfkwikqeqkeeqkqeqtqdniakifdaqpanfeqtdqgfikakq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2cmxA (A:)
  tlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerhpdecevqyk
  nrkttfkwik