PDB entry 2cmw

View 2cmw on RCSB PDB site
Description: structure of human casein kinase 1 gamma-1 in complex with 2-(2-hydroxyethylamino)-6-(3-chloroanilino)-9-isopropylpurine (casp target)
Class: transferase
Keywords: wnt signaling pathway, serine/threonine-protein kinase, kinase, transferase, ATP-binding, phosphorylation, nucleotide-binding, serine/threonine protein kinase
Deposited on 2006-05-15, released 2006-06-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2CMW (Start-1)
    • Uniprot Q9HCP0 (2-End)
    Domains in SCOPe 2.04: d2cmwa_
  • Heterogens: OLP, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cmwA (A:)
    smrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlgsageglp
    qvyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqllsrmeyvhsknliy
    rdvkpenfligrqgnkkehvihiidfglakeyidpetkkhipyrehksltgtarymsint
    hlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkrntpiealcenf
    peematylryvrrldffekpdyeylrtlftdlfekkgytfdyaydwvgrpiptpvgsvhv
    dsgasaitre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cmwA (A:)
    mrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlgsageglpq
    vyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqllsrmeyvhsknliyr
    dvkpenfligrqgnkkehvihiidfglakeyidpetkkhipyrehkslgtarymsinthl
    gkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkrntpiealcenfpe
    ematylryvrrldffekpdyeylrtlftdlfekkgytfdyaydwvgrpiptpvgs