PDB entry 2cmv

View 2cmv on RCSB PDB site
Description: crystal structure of mouse cytosolic isocitrate dehydrogenase complexed with cadmium and citrate
Class: oxidoreductase
Keywords: tricarboxylic acid cycle, isocitrate dehydrogenase, nadp, cadmium, oxidoreductase, glyoxylate bypass
Deposited on 2006-05-15, released 2007-05-29
Made obsolete by 5yzi on 2018-06-27

The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmva_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmvb_
  • Heterogens: CD, NAP, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmvA (A:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cmvB (B:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cmvB (B:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqa